PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.15697s0347.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 841aa    MW: 92284.7 Da    PI: 6.3678
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.15697s0347.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-192078357
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                          k  ++t+eq+e+Le++++++++ps  +r++L +++    +++ rq+kvWFqNrR +ek+
  Bostr.15697s0347.1.p 20 KYVRYTPEQVEALERVYAECPKPSSLRRQQLIRECpilcNIEPRQIKVWFQNRRCREKQ 78
                          5678*****************************************************97 PP

2START171.17.4e-541693772205
                           HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT.. CS
                 START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg.. 88 
                           +aee+++e++ ka+ ++  Wv++  +++g++++ +++ s+++sg a+ra+g+v  ++   v+e+l+d++ W ++++ +etl+vi +g  
  Bostr.15697s0347.1.p 169 IAEETLAEFLCKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGIAARACGLVSLEPI-KVAEILKDRPSWFRDCRCVETLNVIPTGng 256
                           7899******************************************************.8888888888******************** PP

                           EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
                 START  89 galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvdlk 173
                           g+++l +++ +a+++l++ Rdf+++Ry+ +l++g++v++++S+++ +  p+   sss+vRa++l Sg+li+p+++g+s +++v+hvdl+
  Bostr.15697s0347.1.p 257 GTIELVNTQIYAPTTLAAaRDFWTLRYSTSLEDGSYVVCERSLTPATGGPNgplSSSFVRAKMLSSGFLIRPCDGGGSIIHIVDHVDLD 345
                           **************************************************99************************************* PP

                           SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                 START 174 grlphwllrslvksglaegaktwvatlqrqce 205
                            ++++++lr+l++s+ + ++k++va+l++ ++
  Bostr.15697s0347.1.p 346 VSSVPEVLRPLYESSKILAQKMTVAALRHVRQ 377
                           ***************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.4511579IPR001356Homeobox domain
SMARTSM003894.2E-161783IPR001356Homeobox domain
SuperFamilySSF466891.41E-161981IPR009057Homeodomain-like
CDDcd000865.82E-172080No hitNo description
PfamPF000462.5E-162178IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.0E-192278IPR009057Homeodomain-like
CDDcd146863.21E-672111No hitNo description
PROSITE profilePS5084825.143159387IPR002913START domain
CDDcd088753.03E-70163379No hitNo description
SuperFamilySSF559612.33E-34168380No hitNo description
SMARTSM002345.2E-51168378IPR002913START domain
Gene3DG3DSA:3.30.530.202.1E-18168373IPR023393START-like domain
PfamPF018523.8E-51169377IPR002913START domain
PfamPF086701.5E-49693839IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009855Biological Processdetermination of bilateral symmetry
GO:0009880Biological Processembryonic pattern specification
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0080060Biological Processintegument development
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
MMAHSMDDRD SPDKGFDSGK YVRYTPEQVE ALERVYAECP KPSSLRRQQL IRECPILCNI  60
EPRQIKVWFQ NRRCREKQRK ESARLQTVNR KLSAMNKLLM EENDRLQKQV SHLVYENGFM  120
KHRIHTASGT TTDNSCESVV VSGQQRQQQN PRHQHPQLDA NNPANLLSIA EETLAEFLCK  180
ATGTAVDWVQ MIGMKPGPDS IGIVAVSRNC SGIAARACGL VSLEPIKVAE ILKDRPSWFR  240
DCRCVETLNV IPTGNGGTIE LVNTQIYAPT TLAAARDFWT LRYSTSLEDG SYVVCERSLT  300
PATGGPNGPL SSSFVRAKML SSGFLIRPCD GGGSIIHIVD HVDLDVSSVP EVLRPLYESS  360
KILAQKMTVA ALRHVRQIAQ ETSGEVQYSG GRQPAVLRTF SQRLCRGFND AVNGFADDGW  420
SPMSSDGGED ITIMINSSSA KFAGSQYGSS FLPSFGSGVL CAKASMLLQN VPPLVLIRFL  480
REHRAEWADY GVDAYSAASL RATPFAVPCV RTGGFPSNQV ILPLAQTLEH EEFLEVVRLG  540
GHAYSPEDMG LSRDVYLLQL CSGVDENEVG GCAQLVFAPI DESFADDAPL LPSGFRVIPL  600
EQKMNPNDHQ SANRTRDLAS SLDGSTKTDS ETNSRLVLTI AFQFTFDNHS RDNVATMARQ  660
YVRNVVGSIQ RVALAITPRP GSMQLPTSPE ALTLVRWITR SYSIHTGADL FGSDSQSCGG  720
DALLKQLWNH SDAILCCSLK TNASPVFTFA NQAGLDMLET TLVALQDIML DKTLDDSGRK  780
ALCSEFAKIM QQGYANLPAG ICVSSMGRPV SYEQATVWKV VDDNESNHCL AFILVNWSFV  840
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00170DAPTransfer from AT1G30490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4409670.0AJ440967.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein (hb9 gene).
GenBankAK2265700.0AK226570.1 Arabidopsis thaliana mRNA for HD-Zip protein, complete cds, clone: RAFL07-12-P11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010460847.10.0PREDICTED: homeobox-leucine zipper protein ATHB-9
SwissprotO042920.0ATBH9_ARATH; Homeobox-leucine zipper protein ATHB-9
TrEMBLD7KFK40.0D7KFK4_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__3231__AT1G30490.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42562653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30490.10.0HD-ZIP family protein